DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and Gsc

DIOPT Version :10

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001178802.1 Gene:Gsc / 317715 RGDID:631425 Length:256 Species:Rattus norvegicus


Alignment Length:136 Identity:33/136 - (24%)
Similarity:52/136 - (38%) Gaps:31/136 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   705 SLIPLQPSGGSSLLNINPSENRSDVELNLSNNVGLYSTPTVLPSFNH---YSAGCSSVVPGSDY- 765
            :::..:|....::|.:.||.                :.|.|.|:.:.   |.||..:   .||| 
  Rat    10 NILAARPRCKDAVLPVAPSA----------------AAPVVFPALHGDSLYGAGGGT---SSDYG 55

  Fly   766 AYNPAYTQYGGAYGSYGYGTGSGLINSSYYYESGQTQS----PLTHDLRSPLVATRANSLASA-- 824
            |:.|.....|||......| ||.|..:||:|.....|:    |.......||.|.:.:.:.:.  
  Rat    56 AFYPRPVAPGGAGLPAAVG-GSRLGYNSYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPG 119

  Fly   825 -ASPGS 829
             ..|||
  Rat   120 YEGPGS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
GscNP_001178802.1 Homeodomain 161..217 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.