DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and Dux4

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_006252740.1 Gene:Dux4 / 306226 RGDID:1311053 Length:357 Species:Rattus norvegicus


Alignment Length:356 Identity:73/356 - (20%)
Similarity:124/356 - (34%) Gaps:94/356 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 VFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRY-----------YETGSFK 238
            |:....|.||        ||..|    .::::|.:|.   |:|::.:           :|..|.:
  Rat    31 VWFEKNPNPD--------LATRG----HLAKKLGISE---SQIMTWFQKHRKIRKQVEFECCSEE 80

  Fly   239 AGVIGGSKPKVATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSVSSINRIVRNKAA 303
            :...|..||:|..       |...|.:.|.|..:|    |.||. .::..|.:     :.|.|.|
  Rat    81 SQEQGQDKPRVKE-------AGRSRTHFTKFQIDI----LIEAF-EKNRFPGI-----VTREKLA 128

  Fly   304 EKAKHVHHHQQHHVSQSLGGGHIATESVDSSTGTIGEPQPP---------TSNSSANSVNTNVSA 359
            ::. .:...:.|...|:....|     .|...||.....||         |:...|.|.:...|.
  Rat   129 QET-GIPESRIHIWFQNRRARH-----PDPKQGTRATSHPPESSQCPAQKTTGQLAPSKDPTSSC 187

  Fly   360 SASVHASIPTSGTDSVQVSVGHINANSNETTHINSTAEQRTTGYSINGILGIQH----------- 413
            |..:..|.|.:....:.:|.|. .....|||.:..:...:..|...|..|.|.|           
  Rat   188 SVILPLSPPHTPNGPLDLSRGR-QKQLPETTVLQPSQVVQRRGDDQNPSLFIDHLSEVKSPGEKE 251

  Fly   414 GHHS------------HNNNNNSSVN---NNNNTESSCKRKRIEAHDENHDTNIHSDNDDGKRQR 463
            |.|:            ||.:.||.::   ..::|:.|...:.....|:. |.......|:..:..
  Rat   252 GFHTQAPLQLPIQKRGHNPSENSGLSVPPLEDSTQVSAVNQHFRKPDQK-DLAFLQHWDEWFQSM 315

  Fly   464 MSTYSGDQLYTNIWSGKWCIKDD-HKLLAEL 493
            ::.:..|:       |.|.:|.| |...|:|
  Rat   316 LAEWMPDK-------GYWAVKTDLHPWQAQL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645 26/124 (21%)
Dux4XP_006252740.1 homeodomain 15..71 CDD:238039 11/54 (20%)
Homeobox 97..149 CDD:278475 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.