DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and mixl1

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_571015.3 Gene:mixl1 / 30115 ZFINID:ZDB-GENE-000208-20 Length:327 Species:Danio rerio


Alignment Length:310 Identity:61/310 - (19%)
Similarity:98/310 - (31%) Gaps:111/310 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 SGTDSVQVSVGHINANSNETTHINSTAEQRTTGYSI--NGILGIQHGHHSHNNNNNSSVNNNNNT 432
            :|....::.|...|..:.....:..:...:|:|..:  |.:|  .|...:|  .|:|.:.|...|
Zfish    95 TGLPESRIQVWFQNRRAKSRRQVGISIPNKTSGNILTPNNLL--MHQFTTH--QNHSGLENLQRT 155

  Fly   433 ESSCKRKRIEAHDENHDTNIHSDNDDGKRQRMSTYSGDQLY--TNIWSGKWC---------IKDD 486
            .:.       ..|..|...|:|     ..:::||..|| :|  |.|    .|         ||.|
Zfish   156 STF-------TADSFHQQLINS-----SEEKISTIKGD-IYDPTTI----PCMFSRTQENPIKTD 203

  Fly   487 HKLLAELGNLTASTGNCPATYYEASNGFSTTPISGSGATASGNDTSMLYDSITTISQ--TQSSIY 549
            |..:.           .|.:|.:      ..|......|.|.|...      :|:.|  .:...:
Zfish   204 HLSVV-----------VPRSYTQ------QYPKEHEQFTHSANHAK------STMKQFLVEYDNF 245

  Fly   550 TP--AIGPSIGTGSLTPLVPISMHEMKLSANSIQEQTVPPFYTALAFDGNYTSMTSLENCSSLVG 612
            .|  .|||                |||:        .:||                      |..
Zfish   246 PPNKTIGP----------------EMKV--------VIPP----------------------LPS 264

  Fly   613 QEHIVMPESSDSNTLCPI---STRIVPDITETNS-TRVKEPLTNSDGCSE 658
            |.:.:|..||..:..|.:   |.:..|::..|.| .|..|.:..||..|:
Zfish   265 QSNFMMSSSSPKHIACSVQNMSVQTQPELFATFSPIRASEAVEFSDSDSD 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
mixl1NP_571015.3 Homeobox 61..114 CDD:278475 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.