DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and GSC2

DIOPT Version :10

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_005306.1 Gene:GSC2 / 2928 HGNCID:4613 Length:205 Species:Homo sapiens


Alignment Length:72 Identity:19/72 - (26%)
Similarity:32/72 - (44%) Gaps:13/72 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 RENPTMFAWEIRDRLLAEAICSQDNVPSVSSINRI-----VRNKAAE------KAKHVHHHQQHH 316
            |.:.|:|:.|....|  ||:..|:..|.||:..|:     :|.:..|      :||..|..:...
Human   127 RRHRTIFSEEQLQAL--EALFVQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAKWRHQKRASA 189

  Fly   317 VSQSLGG 323
            .::.|.|
Human   190 SARLLPG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645 12/40 (30%)
GSC2NP_005306.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..58
Homeodomain 127..183 CDD:459649 16/57 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..205 2/12 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.