DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sv and sebox

DIOPT Version :9

Sequence 1:	NP_524633.3	Gene:	sv / 43825	FlyBaseID:	FBgn0005561	Length:	844	Species:	Drosophila melanogaster
Sequence 2:	NP_001306981.1	Gene:	sebox / 282666	ZFINID:	ZDB-GENE-021206-4	Length:	293	Species:	Danio rerio

Alignment Length:	142	Identity:	29/142 - (20%)
Similarity:	47/142 - (33%)	Gaps:	58/142 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly    48 HDSQHLQQ-----HHLTHHQQQ--------------DVSPTLHNL-----QNTRT-GDSLSTTIN 87
            |...:|:|     ..|.||||.              .:||.|..:     :|:.| |||..::..
Zfish   138 HPDLNLEQSPEANKSLRHHQQSLIRQALNPWPQNRPPISPDLPEILQWANRNSETPGDSSFSSCP 202

  Fly    88 TNQNQHGHQHLSGS----------------------NMYTS-----------SQMEDKSKANKYD 119
            :.:.||...:.|.|                      .:|:|           |.:|:..:.....
Zfish   203 SERIQHPFPNQSSSVWQMNCFAAHPEGLKSYCTTSQALYSSVSVDQMIPAHPSSLEEALQRQALT 267

  Fly   120 EYSSRTLSNISD 131
            .|...:|.:|||
Zfish   268 HYPQTSLGDISD 279

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sv	NP_524633.3	PAX	175..299	CDD:128645
sebox	NP_001306981.1	COG5576	13..159	CDD:227863	7/20 (35%)
		Homeobox	61..112	CDD:278475
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	117..144		1/5 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0849
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900