DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and Gm4981

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001030041.1 Gene:Gm4981 / 245263 MGIID:3645498 Length:291 Species:Mus musculus


Alignment Length:272 Identity:57/272 - (20%)
Similarity:90/272 - (33%) Gaps:100/272 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 RQRMSTYSG---DQLYTNIWSGKWCIKDDHKLLAELGNLTASTGNCPATYYEASNGFSTTPISGS 522
            |:.::..:|   |.::|      | :|:........|..||...:..|:  :.|.|....|: |.
Mouse    35 REELALETGLPEDMIHT------W-LKNKRARRHRRGRPTAQDQDLLAS--QVSGGAPAGPV-GR 89

  Fly   523 GATASGNDTSMLYDSITTISQTQSSIYTPAIGPSIGTGSLTPLVPISMHEMKLSANS----IQEQ 583
            |...:...:....::.:|...|.|:.|:|:.                ..|.:||..|    ..::
Mouse    90 GHEVAQESSLPQEEAGSTGMDTTSTSYSPSF----------------CRESQLSQVSQPRGAGQK 138

  Fly   584 TVPPFYTALAFDGNYTSMTSLENCSSLVGQEHIVMPESSDSNTLCPISTRIVPDITETNSTRVKE 648
            .||               |...|    ||...:::.|..|                   ..:|||
Mouse   139 EVP---------------TQAGN----VGPLELLLDELQD-------------------EVQVKE 165

  Fly   649 ----PLTNSDGCSEDNNKEPEKSNSS-QSSD-------HIASPHLHHIGEEQLRGNRRSNLNAST 701
                ||   |..|:...:|||.|..| ||.|       |.:.|.:            .|.|...:
Mouse   166 HVPDPL---DLGSDPGAREPEGSQDSLQSLDEAANSGWHTSVPSI------------SSTLCRES 215

  Fly   702 HPSSLIPLQPSG 713
            .||.:  .||||
Mouse   216 QPSQV--AQPSG 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
Gm4981NP_001030041.1 homeodomain 6..56 CDD:238039 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.