DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and npax-3

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_502006.2 Gene:npax-3 / 187848 WormBaseID:WBGene00011257 Length:205 Species:Caenorhabditis elegans


Alignment Length:184 Identity:54/184 - (29%)
Similarity:76/184 - (41%) Gaps:55/184 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 HLTHHQQ-----QDVSPTLHNLQNTRTGDSLSTTINTNQNQHGHQHLSGSNMYTSSQMEDKSKAN 116
            |...|:|     .|:| |.|.||.           :.|...:|   :...|.|.|.|.:..|.. 
 Worm     5 HCCDHEQCGSSVIDLS-TPHTLQR-----------DFNNWLNG---IEVPNSYESQQSDSSSSV- 53

  Fly   117 KYDEYSSRTLSNISDANTTPSANNFITQSQGIEWITAMNDIQNGAEDSHSSQGSISGDGHGGVNQ 181
              ||..|:|.|.                       |:|.  ||.::|...::..       |.|.
 Worm    54 --DESGSKTSSP-----------------------TSMQ--QNPSQDGRKNRKK-------GTNL 84

  Fly   182 LGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYETG 235
            .|..:..||||....|.||::|.:||::...||:.|.:||||||||:||:..||
 Worm    85 YGRPYCPGRPLSMEERTRIIQLHNNGMKVNAISKSLCISHGCVSKIISRFRATG 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645 28/61 (46%)
npax-3NP_502006.2 PAX 78..200 CDD:128645 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.