DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and pax-1

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_505120.1 Gene:pax-1 / 187105 WormBaseID:WBGene00003937 Length:257 Species:Caenorhabditis elegans


Alignment Length:268 Identity:104/268 - (38%)
Similarity:147/268 - (54%) Gaps:52/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 YSSRTLSNI------SDANTTPSANNFITQSQGIEWITAMNDIQNGAEDSHSSQGSISGDGHGGV 179
            |...|.|::      |..:||||::|.|.|...|...:......:.|:.:.             |
 Worm    14 YHPSTTSDVFWTTTPSSTSTTPSSDNGIQQYSSISTSSGYAPANSPAKTAE-------------V 65

  Fly   180 NQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYETGSFKAGVIGG 244
            ||||||||||||||..:|.:||||:..|.|||||||||::|||||||||:|:.|.|:...|.|||
 Worm    66 NQLGGVFVNGRPLPFEMRCKIVELSRQGTRPCDISRQLKISHGCVSKILTRFSENGTIMPGTIGG 130

  Fly   245 SKPKVATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSVSSINRIVRNK-------- 301
            |:|:|.||.||:.|.:.||.:|.:|||||||||::..||.:.|:||||||:||:|||        
 Worm   131 SRPRVTTPKVVEYIRSLKRSDPGIFAWEIRDRLISADICDRANLPSVSSISRILRNKNGGNSSSS 195

  Fly   302 AAEKAKHV-----HHHQQHHVSQSLGGGHIATESVDSSTGTIGEPQPPTSNSSANSVNTNVSASA 361
            ::.:.:::     ...||.|:.|     |...|               .:|:..|.::.|:....
 Worm   196 SSSQLRYIRDQLAEQQQQQHLQQ-----HQYME---------------YNNNELNQISGNLDYQV 240

  Fly   362 SVHASIPT 369
            |...:.|:
 Worm   241 SSSNTPPS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645 77/123 (63%)
pax-1NP_505120.1 PAX 61..185 CDD:128645 77/136 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.