DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and Pax4

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_035168.1 Gene:Pax4 / 18506 MGIID:97488 Length:349 Species:Mus musculus


Alignment Length:177 Identity:91/177 - (51%)
Similarity:115/177 - (64%) Gaps:12/177 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 DGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYETGSFK 238
            ||...||||||:||||||||...||:||:||..|:|||||||.|:||:|||||||.|||.||..:
Mouse     4 DGLSSVNQLGGLFVNGRPLPLDTRQQIVQLAIRGMRPCDISRSLKVSNGCVSKILGRYYRTGVLE 68

  Fly   239 AGVIGGSKPKVATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSVSSINRIVRNKAA 303
            ...||||||::|||.||..||..|.|.|.:|||||:.:|..|.:|:||..||||||||::|  |.
Mouse    69 PKCIGGSKPRLATPAVVARIAQLKDEYPALFAWEIQHQLCTEGLCTQDKAPSVSSINRVLR--AL 131

  Fly   304 EKAKHVHHHQQHH---VSQSLGGGHIATESVDSSTGTIGEPQPPTSN 347
            ::.:.:|..|...   ::..|...|       |:.|....|.|.||:
Mouse   132 QEDQSLHWTQLRSPAVLAPVLPSPH-------SNCGAPRGPHPGTSH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645 78/123 (63%)
Pax4NP_035168.1 PAX 5..129 CDD:128645 78/123 (63%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 8..64 41/55 (75%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 83..131 26/49 (53%)
Homeobox 174..226 CDD:278475
Transcription repression 278..349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.