DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and alr-1

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_509860.1 Gene:alr-1 / 181302 WormBaseID:WBGene00044330 Length:362 Species:Caenorhabditis elegans


Alignment Length:280 Identity:47/280 - (16%)
Similarity:87/280 - (31%) Gaps:87/280 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 NNNNNSSVNNNNNTESSCKRK-------------------------------------------R 440
            |..|.|..:..|:.:.:.|||                                           |
 Worm    96 NRENGSPSDGTNSPDDNGKRKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELATRVQLTEAR 160

  Fly   441 IEAHDENHDTNIHSDNDDGKRQRMSTY------------SGDQLYTNIWSGKWCIKDDHK----- 488
            ::...:|......      |::|.||:            :||..|..:.|.:......::     
 Worm   161 VQVWFQNRRAKYR------KQERSSTHHPYQAPMSIPNSNGDNPYQMMLSQEAIFAAINQQAAAH 219

  Fly   489 LLAELGNLTASTGNCPATYYEASNGFSTTPISGSGATASGNDTSMLYDSITTISQTQSSIY---- 549
            ||.|...:..|.....:.....:......|.|.:....:.:..:||:..||.:  ||..:|    
 Worm   220 LLNEQVRIATSDRRSQSPSVPVTTSSPILPTSVTPTFQNADALNMLFGGITPV--TQQLLYVQQF 282

  Fly   550 --------TPAIG--PSIGTGSLTPLVPISMHEMKLSANSIQEQTVPPFYTALAFDGNYTSMTSL 604
                    |..:|  |:..|..:|.:|.:...:.|.::.:......|...:..|  ...||.|:.
 Worm   283 SRAMDAFRTQLLGSVPAGATAEVTDVVALKTEDSKSNSRAGSSSPTPTESSGAA--ATSTSPTNF 345

  Fly   605 ENCSSLVGQEHIVMPESSDS 624
            .:.:||:..   |.|:...|
 Worm   346 ADMNSLISD---VKPKEESS 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
alr-1NP_509860.1 Homeobox 121..174 CDD:365835 2/58 (3%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.