DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and GSC

DIOPT Version :10

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_776248.1 Gene:GSC / 145258 HGNCID:4612 Length:257 Species:Homo sapiens


Alignment Length:128 Identity:34/128 - (26%)
Similarity:55/128 - (42%) Gaps:13/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 PSGGSSLLNINPSENR-SDVELNLSNNVGLYSTPTVLPSFNHYSAGCSSVVPGSDY-AYNPAYTQ 773
            |:...|:.||..:..| .|..|.::::.   :.|.|.|:.:..|...:|....||| |:.|....
Human     2 PASMFSIDNILAARPRCKDSVLPVAHSA---AAPVVFPALHGDSLYGASGGASSDYGAFYPRPVA 63

  Fly   774 YGGAYGSYGYGTGSGLINSSYYYESGQTQS----PLTHDLRSPLVATRANSLASA---ASPGS 829
            .||| |.....:||.|..::|:|.....|:    |.......||.|.:.:.:.:.   ..|||
Human    64 PGGA-GLPAAVSGSRLGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
GSCNP_776248.1 Homeodomain 161..217 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..257
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.