DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and DUX4

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001280727.1 Gene:DUX4 / 100288687 HGNCID:50800 Length:424 Species:Homo sapiens


Alignment Length:192 Identity:31/192 - (16%)
Similarity:52/192 - (27%) Gaps:86/192 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   699 ASTHPSSLIPLQPSGGSSLLNINPSENRSDVELNLSNNVGLYSTPTVLPSFNHYSAGCSSVVPGS 763
            |.:||.:  |..|.        :|.::|.|.:                |..:.....|:...|| 
Human   250 ALSHPQA--PRWPP--------HPGKSREDRD----------------PQRDGLPGPCAVAQPG- 287

  Fly   764 DYAYNPAY------------TQYGGAYGSYGYGTGSGLINSSYYYESGQTQSP------------ 804
                 ||.            |..|..:  :|:|.|..:..:::..::|....|            
Human   288 -----PAQAGPQGQGVLAPPTSQGSPW--WGWGRGPQVAGAAWEPQAGAAPPPQPAPPDASASAR 345

  Fly   805 ----------------------------LTHDLRSPLVATRANSLASAASPGSGSACTKSES 838
                                        |...|.||....:|..|....:||...|..::.|
Human   346 QGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAAS 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
DUX4NP_001280727.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Homeobox 27..74 CDD:306543
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..102
Homeobox 97..149 CDD:306543
DNA_pol3_gamma3 <141..319 CDD:331207 19/102 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..362 21/145 (14%)
Required for interaction with EP300 and CREBBP, and for transcriptional activation of target genes. /evidence=ECO:0000269|PubMed:26951377 327..424 12/81 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 388..414 5/20 (25%)
Important for transcriptional activation of target genes. /evidence=ECO:0000269|PubMed:29618456 405..424 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.