Sequence 1: | NP_524633.3 | Gene: | sv / 43825 | FlyBaseID: | FBgn0005561 | Length: | 844 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001373372.1 | Gene: | pax10 / 100192208 | ZFINID: | ZDB-GENE-081022-10 | Length: | 275 | Species: | Danio rerio |
Alignment Length: | 270 | Identity: | 48/270 - (17%) |
---|---|---|---|
Similarity: | 97/270 - (35%) | Gaps: | 101/270 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 419 NNNNNSSVNN----------NNNTESSCKRKRIE-----------AHDENHDTNIHSDNDDGKRQ 462
Fly 463 RMSTYSGDQL-----------YTNIWS-----------------------GKWCIKDDHKLLAEL 493
Fly 494 GNLTASTGNCPATYYEASNGFSTTPI------SGSGATASGNDTSML-YDSITTISQTQSSIYTP 551
Fly 552 AIGPSIGTGSLTPLVPISMHEMKLSANSIQEQTVPPFYTALAFDGNYTSMTSLENCSSLVGQEHI 616
Fly 617 VMPESSDSNT 626 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sv | NP_524633.3 | PAX | 175..299 | CDD:128645 | |
pax10 | NP_001373372.1 | Homeobox | 78..131 | CDD:395001 | 4/54 (7%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |