DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf4 and ARFA1E

DIOPT Version :10

Sequence 1:NP_524631.1 Gene:Arf4 / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_191788.1 Gene:ARFA1E / 825402 AraportID:AT3G62290 Length:181 Species:Arabidopsis thaliana


Alignment Length:180 Identity:150/180 - (83%)
Similarity:159/180 - (88%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65
            |||:...|.::||.||:||||||||||||||||||||||||||||||||||||||||||||.|||
plant     1 MGLSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDL 130
            ||||||||||||||||||||||||||||||||||:.||..||..||.||||||||||||||||||
plant    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDL 130

  Fly   131 PNAMTAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAELAKK 180
            ||||.|||:||||.|:.||.|||:|||||||.|.||||||||||..:|.|
plant   131 PNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf4NP_524631.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 149/178 (84%)
ARFA1ENP_191788.1 PLN00223 1..181 CDD:165788 150/180 (83%)

Return to query results.
Submit another query.