DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf4 and ARLA1B

DIOPT Version :10

Sequence 1:NP_524631.1 Gene:Arf4 / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_190555.2 Gene:ARLA1B / 824148 AraportID:AT3G49860 Length:176 Species:Arabidopsis thaliana


Alignment Length:137 Identity:45/137 - (32%)
Similarity:81/137 - (59%) Gaps:1/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KQMRILMVGLDAAGKTTILYKLKLGEI-VTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWR 79
            |:|.:.:|||..:|||:::..:..||. ...|||:|||:..|..:|:...:||:|||.:.|.:|.
plant    10 KEMELSLVGLQNSGKTSLVNVVATGEYSEDMIPTVGFNMRKVTKENVAIRLWDLGGQPRFRCMWE 74

  Fly    80 HYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKLR 144
            .|.:....:::|||:.|.:.::.:..||.::|....|....|||..||.|:..|::...||:::.
plant    75 RYCRAVSMIVYVVDAADTENLSVSRSELHDLLSNASLIGIPLLVLGNKIDIHGALSKEALTEEMG 139

  Fly   145 LNQLRNR 151
            |:.:.:|
plant   140 LSSVTSR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf4NP_524631.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 45/137 (33%)
ARLA1BNP_190555.2 Arl10_like 13..171 CDD:206724 43/134 (32%)

Return to query results.
Submit another query.