DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf4 and ARFB1C

DIOPT Version :10

Sequence 1:NP_524631.1 Gene:Arf4 / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_186962.1 Gene:ARFB1C / 821079 AraportID:AT3G03120 Length:192 Species:Arabidopsis thaliana


Alignment Length:177 Identity:109/177 - (61%)
Similarity:142/177 - (80%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65
            ||.|...|....||.::||::|:||||||||||||||.:||:::|:||||||||.|:|||:.|||
plant     1 MGQTFRKLFDTFFGNQEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKNVIFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDL 130
            ||||||:|:||||||||.||.|||:||||.||:||.:|::|.|:::::..:.::|:||||||||:
plant    66 WDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQDIIRDPFMLNSVILVFANKQDM 130

  Fly   131 PNAMTAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAEL 177
            ..||:..|:.:.|.|..|:||.|.||.|||.||.|||||||||||.|
plant   131 RGAMSPREVCEGLGLLDLKNRKWHIQGTCALQGDGLYEGLDWLSATL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf4NP_524631.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 109/177 (62%)
ARFB1CNP_186962.1 Arf1_5_like 18..176 CDD:206717 101/157 (64%)

Return to query results.
Submit another query.