DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and Trim23

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_008758905.1 Gene:Trim23 / 81002 RGDID:621587 Length:601 Species:Rattus norvegicus


Alignment Length:164 Identity:99/164 - (60%)
Similarity:128/164 - (78%) Gaps:1/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWR 79
            |.::|::.:|||.|||||||:|||..|.:..|||||||||||||||:.||:|||||:.|:||||:
  Rat   429 KMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWK 493

  Fly    80 HYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKLR 144
            ||:.|||.::|||||:.||||:||..||..:|.|.|||||:||:||||||:..|::..|:|:.|.
  Rat   494 HYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLS 558

  Fly   145 LNQL-RNRHWFIQSTCATQGHGLYEGLDWLSAEL 177
            |::| ..|.|:||...|..|.||||||||||.:|
  Rat   559 LHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQL 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 99/164 (60%)
Trim23XP_008758905.1 zf-RING_UBOX 58..100 CDD:290181
BBOX 152..195 CDD:237988
BBOX 200..246 CDD:197662
BBC 253..397 CDD:128778
ARD1 433..601 CDD:206723 98/160 (61%)
Ras 433..592 CDD:278499 97/158 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.