DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and ARL14

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_079323.1 Gene:ARL14 / 80117 HGNCID:22974 Length:192 Species:Homo sapiens


Alignment Length:156 Identity:74/156 - (47%)
Similarity:120/156 - (76%) Gaps:2/156 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNICFTVWDVGGQDKIRPLWR 79
            ||.::|::|||:|||:|:||||||.:.:|||||||||||.:|. :|:..||||||||:|:|.:|.
Human    12 KQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERNLSLTVWDVGGQEKMRTVWG 76

  Fly    80 HYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKLR 144
            .|.:||.||::||||.|:.|:.|::|:.:::|:.:.:::..:::.|||||:|.|:||.::|...:
Human    77 CYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDITRMFK 141

  Fly   145 LNQL-RNRHWFIQSTCATQGHGLYEG 169
            :.:| .:|:|::|..||..|.||.:|
Human   142 VKKLCSDRNWYVQPCCALTGEGLAQG 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 74/156 (47%)
ARL14NP_079323.1 SAR 1..175 CDD:197556 74/156 (47%)
ARLTS1 15..174 CDD:133356 72/153 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.