DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and arl9

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001038852.1 Gene:arl9 / 751670 ZFINID:ZDB-GENE-060825-210 Length:241 Species:Danio rerio


Alignment Length:145 Identity:51/145 - (35%)
Similarity:80/145 - (55%) Gaps:5/145 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RILMVGLDAAGKTTILYKLKLGEIVTTI-PTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYF 82
            ::|::|||.||||::|:....|.:...: ||.|||..::..:::.....::||.:|:|..||.|.
Zfish    75 QVLVLGLDGAGKTSLLHCFATGSLEQDVSPTQGFNAVSINKEDLQIEFLEIGGSEKLREYWRMYL 139

  Fly    83 QNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKLRLNQ 147
            ...:.|:|||||:|.:|...|:..||.:|..|.....|||  |||||:..|....:|.:.|.|..
Zfish   140 SKARVLVFVVDSSDPERFPLAKHHLQQLLSADPGLPLVLL--ANKQDVSGARGITDLYEALDLGN 202

  Fly   148 LRNRHWFIQSTCATQ 162
            :.:.|..  |...||
Zfish   203 VGDGHQL--SVIGTQ 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 51/145 (35%)
arl9NP_001038852.1 P-loop_NTPase 75..239 CDD:304359 51/145 (35%)
Gem1 75..>184 CDD:224025 41/110 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.