DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and arl5c

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001037909.1 Gene:arl5c / 733518 XenbaseID:XB-GENE-5898153 Length:179 Species:Xenopus tropicalis


Alignment Length:176 Identity:82/176 - (46%)
Similarity:121/176 - (68%) Gaps:3/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISSLLTR---LFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVW 66
            :.::.||   :||.::.::::||||.||||||||:..:.|:|.|.||||.|||.:..:|..|.:|
 Frog     1 MGNIFTRIMSIFGNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTAPTIGSNVEEIISRNTHFLMW 65

  Fly    67 DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLP 131
            |:|||:.:|..|..|:.||:.:|.|:||.||:|:.|...||..||..:||:||.:|:||||||:.
 Frog    66 DIGGQETLRATWNSYYSNTEFVILVIDSTDRERLPETREELYKMLAHEELKDAAILIFANKQDVK 130

  Fly   132 NAMTAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAEL 177
            ::|||:|::..|.|..:|:|.|.||..||..|.||..|||||.:.:
 Frog   131 DSMTASEISSSLALGAIRDRAWHIQGCCALTGEGLPAGLDWLKSRV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 82/176 (47%)
arl5cNP_001037909.1 Arl5_Arl8 3..175 CDD:133353 82/171 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.