DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and arf4

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001025648.1 Gene:arf4 / 595036 XenbaseID:XB-GENE-484079 Length:180 Species:Xenopus tropicalis


Alignment Length:180 Identity:158/180 - (87%)
Similarity:167/180 - (92%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65
            ||||||||.:|||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     1 MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDL 130
            ||||||||||||||||||||||||||||||||:||.||..|||.|||||||||||||||||||||
 Frog    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMLQEDELRDAVLLVFANKQDL 130

  Fly   131 PNAMTAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAELAKK 180
            ||||..:|:||||.|..||||.|::|:||||||.||||||||||.||:|:
 Frog   131 PNAMAISEMTDKLGLQNLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 157/178 (88%)
arf4NP_001025648.1 P-loop_NTPase 1..180 CDD:393355 157/178 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 309 1.000 Domainoid score I1334
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55593
Inparanoid 1 1.050 322 1.000 Inparanoid score I2472
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 1 1.000 - - oto103818
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3279
SonicParanoid 1 1.000 - - X2323
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.