DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and arl14

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001015791.1 Gene:arl14 / 548508 XenbaseID:XB-GENE-5750500 Length:201 Species:Xenopus tropicalis


Alignment Length:173 Identity:85/173 - (49%)
Similarity:118/173 - (68%) Gaps:8/173 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLTISSLLTRLFGK-KQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE-YKNICF 63
            |||:.||     ..| ||.|||::|||.|||:|:|||.|..|...||||:|||||.:. .|::..
 Frog     1 MGLSGSS-----HSKVKQARILILGLDDAGKSTVLYKFKFKEPFITIPTVGFNVEMIHTEKHLQL 60

  Fly    64 TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQ 128
            |:||||||.|:|..|.|||:||.||::||||||...:.|:::|.|::||.:.::|..:::.||||
 Frog    61 TMWDVGGQQKLRSFWCHYFENTDGLVYVVDSNDSKHLDESKKEFQHVLQNELIKDVPVVLLANKQ 125

  Fly   129 DLPNAMTAAELTDKLRLNQ-LRNRHWFIQSTCATQGHGLYEGL 170
            |||.|:.|.|:|.|..:.: ..:|.|::|..||..|.||.|||
 Frog   126 DLPGALNAEEITRKFNMKKYCSDRDWYVQPCCAHTGQGLAEGL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 85/173 (49%)
arl14NP_001015791.1 ARLTS1 15..174 CDD:133356 77/154 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.