DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and Arl2

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster


Alignment Length:167 Identity:78/167 - (46%)
Similarity:112/167 - (67%) Gaps:2/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKQMRILMVGLDAAGKTTILYKLKLGEIVTTI-PTIGFNVETVEYKNICFTVWDVGGQDKIRPLW 78
            :::||||::|||.|||||||.:.. ||.:.|| ||:|||::|:|:......:||||||..:|..|
  Fly    14 EREMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYW 77

  Fly    79 RHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKL 143
            |:||::|.||::||||.||.|:....:|||.:|||:.|..|.|||..||||||.|:::.|:.:.|
  Fly    78 RNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEIL 142

  Fly   144 RLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAELAKK 180
            .|..:...||.:....|..|..|...:|||.|::||:
  Fly   143 HLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 77/165 (47%)
Arl2NP_476886.1 Arl2 3..175 CDD:206720 75/161 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.