DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and Arl8

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster


Alignment Length:163 Identity:50/163 - (30%)
Similarity:91/163 - (55%) Gaps:1/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFGKKQMRILMVGLDAAGKTTILYKLKLGEIV-TTIPTIGFNVETVEYKNICFTVWDVGGQDKIR 75
            :|.|::|.:.:|||..:||||.:..:..|:.. ..|||:|||:..:...|:...|||:|||.:.|
  Fly    15 IFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTIKVWDIGGQPRFR 79

  Fly    76 PLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELT 140
            .:|..|.:....::::||:.|.|::..:..||.::|.:.:|....:||..||:|||.|:....|.
  Fly    80 SMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLI 144

  Fly   141 DKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWL 173
            :::.|:.:::|.....|....:...:...|.||
  Fly   145 ERMNLSSIQDREICCYSISCKEKDNIDITLQWL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 50/163 (31%)
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 47/156 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.