DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf4 and ARL3

DIOPT Version :10

Sequence 1:NP_524631.1 Gene:Arf4 / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_004302.1 Gene:ARL3 / 403 HGNCID:694 Length:182 Species:Homo sapiens


Alignment Length:183 Identity:82/183 - (44%)
Similarity:122/183 - (66%) Gaps:5/183 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLTISSLLTRLFG--KKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICF 63
            |||.  |:|.:|..  .:::|||::|||.|||||:|.:|...:|....||.|||:::|:.:....
Human     1 MGLL--SILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKL 63

  Fly    64 TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQ 128
            .|||:|||.||||.|::||:||..||:|:||.||.|..|..:||..:|:|::|....:|:|||||
Human    64 NVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQ 128

  Fly   129 DLPNAMTAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAEL-AKK 180
            ||..|..|:|:.:.|.|:.:|:|.|.|||..|..|.|:.:|::|:...: |||
Human   129 DLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf4NP_524631.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 80/181 (44%)
ARL3NP_004302.1 Arl3 3..176 CDD:206721 77/174 (44%)

Return to query results.
Submit another query.