DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and ARL4D

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001652.2 Gene:ARL4D / 379 HGNCID:656 Length:201 Species:Homo sapiens


Alignment Length:188 Identity:76/188 - (40%)
Similarity:115/188 - (61%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-----KN 60
            |..|.||.|...   :.:.::::|||:||||::||:||..|.|.::||.|||.|.:..     :.
Human     8 MAPTASSFLPHF---QALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRG 69

  Fly    61 ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFA 125
            |.|.|||||||:|:|||||.|.:.|.||:||||:.:.:|:.||:.||..:.:..:.:...:||.|
Human    70 ITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLA 134

  Fly   126 NKQDLPNAMTAAELTDKLRLNQLRN---RHWFIQSTCATQGHGLYEGLDWLSAELAKK 180
            ||||.|.|::|||:..:|.:.:|..   .|  :|...|..|.||.:||:.|...:.|:
Human   135 NKQDQPGALSAAEVEKRLAVRELAAATLTH--VQGCSAVDGLGLQQGLERLYEMILKR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 75/186 (40%)
ARL4DNP_001652.2 P-loop_NTPase 19..201 CDD:422963 71/177 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.