DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and arf5

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_954969.1 Gene:arf5 / 378724 ZFINID:ZDB-GENE-030910-5 Length:180 Species:Danio rerio


Alignment Length:180 Identity:155/180 - (86%)
Similarity:165/180 - (91%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65
            ||||||||..|||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish     1 MGLTISSLFGRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDL 130
            ||||||||||||||||||||||||||||||||:|:.|:..||..|||||||||||||||||||||
Zfish    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVAESAEELSKMLQEDELRDAVLLVFANKQDL 130

  Fly   131 PNAMTAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAELAKK 180
            ||||..:||||||.|..||:|.|::|:||||||.||||||||||.||:|:
Zfish   131 PNAMAVSELTDKLGLQSLRSRTWYVQATCATQGTGLYEGLDWLSNELSKR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 154/178 (87%)
arf5NP_954969.1 YlqF_related_GTPase 1..180 CDD:424112 154/178 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581996
Domainoid 1 1.000 305 1.000 Domainoid score I1340
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I2506
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 1 1.000 - - otm25955
orthoMCL 1 0.900 - - OOG6_107097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2323
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.670

Return to query results.
Submit another query.