DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and ARF4

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001651.1 Gene:ARF4 / 378 HGNCID:655 Length:180 Species:Homo sapiens


Alignment Length:180 Identity:152/180 - (84%)
Similarity:164/180 - (91%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65
            ||||||||.:|||||||||||||||||||||||||||||||||||||||||||||||||||||||
Human     1 MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDL 130
            |||||||:|||||:||||||||||||||||||:||.|...|||.||..|||||||||:|||||||
Human    66 WDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDL 130

  Fly   131 PNAMTAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAELAKK 180
            ||||..:|:||||.|..||||.|::|:||||||.||||||||||.||:|:
Human   131 PNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 151/178 (85%)
ARF4NP_001651.1 YlqF_related_GTPase 1..180 CDD:424112 151/178 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 300 1.000 Domainoid score I1424
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55593
Inparanoid 1 1.050 315 1.000 Inparanoid score I2562
Isobase 1 0.950 - 0 Normalized mean entropy S45
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 1 1.000 - - otm41342
orthoMCL 1 0.900 - - OOG6_107097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3279
SonicParanoid 1 1.000 - - X2323
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.720

Return to query results.
Submit another query.