DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and Arl6

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster


Alignment Length:169 Identity:58/169 - (34%)
Similarity:98/169 - (57%) Gaps:6/169 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKQMRILMVGLDAAGKTTILYKLKLGEIVTTI--PTIGFNVET--VEYKNICFTVWDVGGQDKIR 75
            |.:|.||::||:.:||::|:...|.....|:|  ||:||.||.  :....:.....|:.|..:.|
  Fly    15 KDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYR 79

  Fly    76 PLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDEL--RDAVLLVFANKQDLPNAMTAAE 138
            .||.|.|:|..|:|:|:||:||.|....:.||..:||..:|  |...:|.:.||.|:.:::::.:
  Fly    80 NLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVK 144

  Fly   139 LTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAEL 177
            :...|||..::::.|.|.|:.|..|.||.||:.||..::
  Fly   145 IAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQM 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 58/169 (34%)
Arl6NP_611421.1 Arl6 19..182 CDD:206722 56/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455853
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.