DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and Arl11

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001013451.1 Gene:Arl11 / 364396 RGDID:1308083 Length:173 Species:Rattus norvegicus


Alignment Length:151 Identity:62/151 - (41%)
Similarity:99/151 - (65%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK-NICFTVWDVGGQDKIRPLWRHYF 82
            :::|:|||.|||||||||||...:|.|:||:|||||.:|.. ::..|:||:|||.::|..|:.|.
  Rat    12 QVVMLGLDCAGKTTILYKLKGNRLVDTLPTVGFNVEPLEAPGHVSLTLWDIGGQTQLRATWKDYL 76

  Fly    83 QNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKLRLNQ 147
            :....|::|:||.|..|:.||..||:.:|::..:.....||.||||:.|:|:...|:.::|.|.:
  Rat    77 EGIDLLVYVLDSTDEARLPEAVAELEEVLEDPNMAGVPFLVLANKQEAPDALPLLEIRNRLDLER 141

  Fly   148 LRNRHWFIQSTCATQGHGLYE 168
            .::..|.:::..|..|.||.|
  Rat   142 FQDHCWELRACSALTGQGLQE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 62/151 (41%)
Arl11NP_001013451.1 P-loop_NTPase 12..167 CDD:304359 62/151 (41%)
Ras 13..172 CDD:278499 62/150 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.