DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and arl4ab

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_956612.1 Gene:arl4ab / 338267 ZFINID:ZDB-GENE-030219-167 Length:201 Species:Danio rerio


Alignment Length:170 Identity:75/170 - (44%)
Similarity:106/170 - (62%) Gaps:7/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY------KNICFTVWDVGGQDKIRP 76
            :.|:::|||.|||||:||:|:..|.|.|:||.|||.|.::.      :...|..||||||:|:||
Zfish    21 LHIVILGLDCAGKTTVLYRLRFNEFVNTVPTKGFNTEKIKVNLGPKSRTATFHFWDVGGQEKLRP 85

  Fly    77 LWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTD 141
            |||.|.:...||:|||||.|.:|:.||:.||..:.:..|.....:||.||||||.:|:..:|:..
Zfish    86 LWRSYTRCADGLVFVVDSVDAERMEEAKTELHKITRLQENLGVPVLVVANKQDLRSALPLSEVEQ 150

  Fly   142 KLRLNQL-RNRHWFIQSTCATQGHGLYEGLDWLSAELAKK 180
            .|.||:| .:..|.:|..||..|.||.|||:.|...:.|:
Zfish   151 MLALNELGSHTPWHLQPACAIIGEGLQEGLERLHTMIIKR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 74/168 (44%)
arl4abNP_956612.1 Arl4_Arl7 18..201 CDD:206719 75/170 (44%)
Gem1 23..>148 CDD:224025 58/124 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.