DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and arl11

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_955987.1 Gene:arl11 / 324689 ZFINID:ZDB-GENE-030131-3410 Length:176 Species:Danio rerio


Alignment Length:168 Identity:76/168 - (45%)
Similarity:116/168 - (69%) Gaps:4/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNICFTVWDVGGQDKIRPLW 78
            ||..::|::|||:|||:|::|:...|.|:.|.||:||||.|::. |....||||:||||.:||.|
Zfish    10 KKPPQVLIMGLDSAGKSTLMYRQLHGVIMQTSPTVGFNVATLQLNKKTSLTVWDIGGQDTMRPNW 74

  Fly    79 RHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKL 143
            ::|.:..:.|:|||||:|..||.||::.|:.:|.::.|:...|:|.|||:||||.||..|::.||
Zfish    75 KYYLEGCKVLVFVVDSSDYARIGEAQKALKKILHDEHLKGVPLMVLANKKDLPNTMTIREVSTKL 139

  Fly   144 RLNQLRNRHWFIQSTCATQGHGLYEGLDWLS-AELAKK 180
            .|:...:|.|.||:..|.:|.||.:.  :|| |:|.:|
Zfish   140 DLDTYTDRQWEIQACSAVKGLGLQQA--FLSIAKLLQK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 75/166 (45%)
arl11NP_955987.1 small_GTP 12..166 CDD:272973 69/155 (45%)
ARLTS1 14..172 CDD:133356 72/159 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.