DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and Arfrp1

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster


Alignment Length:169 Identity:60/169 - (35%)
Similarity:93/169 - (55%) Gaps:20/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILMVGLDAAGKTTIL----------YK-LKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDK 73
            ::::|||.|||||.|          || |...:|.|   |:|.|:.|::.:.:....||:|||.:
  Fly    20 VVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITT---TVGLNIGTIDVQGVRLNFWDLGGQQE 81

  Fly    74 IRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAE 138
            ::.||..|:|.:.|:|:|:|||||:|:.|::.....|::.:.|....||:.|||||||:.|...|
  Fly    82 LQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGVRE 146

  Fly   139 LTDKLRLNQ----LRNRHWFIQSTCATQGHGLYEGLDWL 173
            :  |....|    :..|........|..|.|:.||:.||
  Fly   147 I--KPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 60/169 (36%)
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 58/165 (35%)
Arfrp1 19..186 CDD:206725 60/169 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.