DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf4 and Sar1b

DIOPT Version :10

Sequence 1:NP_524631.1 Gene:Arf4 / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001009622.1 Gene:Sar1b / 287276 RGDID:1305590 Length:198 Species:Rattus norvegicus


Alignment Length:174 Identity:51/174 - (29%)
Similarity:93/174 - (53%) Gaps:16/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWR 79
            ||..:::.:|||.|||||:|:.||...:...:||:....|.:....:.||.:|:||..:.|.:|:
  Rat    23 KKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHLQARRVWK 87

  Fly    80 HYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTD--- 141
            :|.....|::|:||..|.:|:.|::.||.:::.::.:.:..:|:..||.|.|.|::...|.:   
  Rat    88 NYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFG 152

  Fly   142 ---------KLRLNQLRNR--HWFIQSTCATQGHGLYEGLDWLS 174
                     .:.|.:|..|  ..|:.|....||:|  ||..|::
  Rat   153 LYGQTTGKGSVSLKELNARPLEVFMCSVLKRQGYG--EGFRWMA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf4NP_524631.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 51/174 (29%)
Sar1bNP_001009622.1 Sar1 3..197 CDD:206645 51/174 (29%)
STAR, SAR1-N-terminal activation recruitment. Required for the activation by PREB and subsequent recruitment to ER membrane. /evidence=ECO:0000250|UniProtKB:Q9QVY3 3..5
Mediates recruitment to ER membranes. /evidence=ECO:0000250|UniProtKB:Q9QVY3 15..19
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.