DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and arf6

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_596822.1 Gene:arf6 / 2539937 PomBaseID:SPBC1539.08 Length:184 Species:Schizosaccharomyces pombe


Alignment Length:169 Identity:112/169 - (66%)
Similarity:136/169 - (80%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG 70
            |...:|||..|:|||||:||||||||||||||||.:.|.||||:|||||||.||||.|.||||||
pombe    10 SKPFSRLFSNKEMRILMLGLDAAGKTTILYKLKLNQSVVTIPTVGFNVETVTYKNIKFNVWDVGG 74

  Fly    71 QDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMT 135
            ||||||||||||..|:||||||||.|.:||:||.:||..::.:.|:||.:|||.|||||||.|::
pombe    75 QDKIRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIISDREMRDCLLLVLANKQDLPGALS 139

  Fly   136 AAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLS 174
            .|::||.|:|::|::|.|.:|.|||..|.||.|||.|||
pombe   140 PAQITDVLQLDKLKDRLWNVQPTCALTGDGLLEGLAWLS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 112/169 (66%)
arf6NP_596822.1 Arf6 13..180 CDD:206716 111/166 (67%)
SAR 19..179 CDD:197556 108/160 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.