DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and arf-6

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_503011.1 Gene:arf-6 / 191608 WormBaseID:WBGene00000184 Length:175 Species:Caenorhabditis elegans


Alignment Length:170 Identity:109/170 - (64%)
Similarity:141/170 - (82%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVG 69
            :...|:::||||::||||:|||||||||||||||||:.||||||:|||||||.||||.|.|||||
 Worm     1 MGKFLSKIFGKKELRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNIKFNVWDVG 65

  Fly    70 GQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAM 134
            ||||||||||||:..||.||||:|:.||||:.||..||..::.:.|:::|::|||||||||.:||
 Worm    66 GQDKIRPLWRHYYTGTQALIFVMDAADRDRVDEARMELHRIINDREMKEAIILVFANKQDLADAM 130

  Fly   135 TAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLS 174
            ...|:.|||.|.::|:|:|::|.:||:.|.||:|||.|||
 Worm   131 KPHEIQDKLGLTRIRDRNWYVQPSCASTGDGLHEGLTWLS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 109/170 (64%)
arf-6NP_503011.1 Arf6 5..172 CDD:206716 109/166 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.