DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf4 and Arl8

DIOPT Version :10

Sequence 1:NP_524631.1 Gene:Arf4 / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_313136.3 Gene:Arl8 / 1274069 VectorBaseID:AGAMI1_015073 Length:186 Species:Anopheles gambiae


Alignment Length:177 Identity:56/177 - (31%)
Similarity:96/177 - (54%) Gaps:8/177 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLTR-------LFGKKQMRILMVGLDAAGKTTILYKLKLGEIV-TTIPTIGFNVETVEYKNICF 63
            :||.|       ||.|::|.:.:|||..:||||.:..:..|:.. ..|||:|||:..|...|:..
Mosquito     3 ALLNRILDWFKSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFCEDMIPTVGFNMRKVTKGNVTI 67

  Fly    64 TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQ 128
            .|||:|||.:.|.:|..|.:....::::||:.|.|::..:..||.::|.:.:|....:||..||:
Mosquito    68 KVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKMEASRNELHSLLDKPQLAGIPVLVLGNKR 132

  Fly   129 DLPNAMTAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSA 175
            |:|.|:....|.|::.|:.:::|.....|....:...:...|.||.|
Mosquito   133 DIPGALEETGLIDRMNLSSIQDREICCYSISCKEKDNIDITLQWLIA 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf4NP_524631.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 56/177 (32%)
Arl8XP_313136.3 Arl10_like 22..180 CDD:206724 49/158 (31%)

Return to query results.
Submit another query.