DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf102F and si:ch1073-165f9.2

DIOPT Version :9

Sequence 1:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_002663882.1 Gene:si:ch1073-165f9.2 / 100333040 ZFINID:ZDB-GENE-141216-228 Length:181 Species:Danio rerio


Alignment Length:180 Identity:130/180 - (72%)
Similarity:147/180 - (81%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65
            ||:..|||.||||.||:.|:||.|||||||||:||||||||:|||||||||||||||||||.|||
Zfish     1 MGVFFSSLWTRLFEKKETRLLMFGLDAAGKTTVLYKLKLGEVVTTIPTIGFNVETVEYKNISFTV 65

  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDL 130
            ||..||..::.|||||:.|||||||||||:|||||..|..||..:|.|||||||||||.||||||
Zfish    66 WDFSGQTTMKSLWRHYYSNTQGLIFVVDSSDRDRIETAAEELNLLLAEDELRDAVLLVLANKQDL 130

  Fly   131 PNAMTAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAELAKK 180
            |.||.|.||||:|.|:.|..|.||:|||||.||.|||||.|||:.:|:|:
Zfish   131 PKAMPAQELTDRLGLHALTGRQWFVQSTCAVQGSGLYEGFDWLTDQLSKQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 129/178 (72%)
si:ch1073-165f9.2XP_002663882.1 P-loop_NTPase 1..180 CDD:304359 129/178 (72%)
SAR 15..174 CDD:197556 118/158 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581997
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.