DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11155 and Ir40a

DIOPT Version :9

Sequence 1:NP_651941.2 Gene:CG11155 / 43822 FlyBaseID:FBgn0039927 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster


Alignment Length:539 Identity:115/539 - (21%)
Similarity:192/539 - (35%) Gaps:124/539 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 WHPDDGVNISD----PTAF--YDSNIANITLVVMTREERPYVMV-------KEDK---------- 444
            |:..|.:.:..    |||.  | :|....|..|......|:..|       :||:          
  Fly   189 WYDGDNLGLQRIPLLPTALSVY-ANFKGRTFRVPVFHSPPWFWVTYCNNSFEEDEEFNSLDSIEK 252

  Fly   445 ---NLTGNLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPE-----TNSWNGIVQELMER 501
               .:||     |....||..::..:.|::|....|....|....|     .:|:.|.:..|...
  Fly   253 RKVRVTG-----GRDHRLLMLLSKHMNFRFKYIEAPGRTQGSMRSEDGKDSNDSFTGGIGLLQSG 312

  Fly   502 RADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRL---FSFMNPLAIEIWLYVLAA 563
            :||..:..:.:::.|...|:|:  |..|.....|  .|..|.||   .:.|.|...:||.:::..
  Fly   313 QADFFLGDVGLSWERRKAIEFS--FFTLADSGAF--ATHAPRRLNEALAIMRPFKQDIWPHLILT 373

  Fly   564 YILVSFALFVMARFSPYEWKNP--------------HPCY-KE-----------TDIVENQFS-- 600
             |:.|..:|......||.|:..              |..| ||           |.:..:|..  
  Fly   374 -IIFSGPIFYGIIALPYIWRRRWANSDVEHLGELYIHMTYLKEITPRLLKLKPRTVLSAHQMPHQ 437

  Fly   601 -ISNSFWFITGTFLRQG-----SGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMIS 659
             .....||....||:|.     :|...|..:  ||  .|.....::...|:|.|.:.........
  Fly   438 LFQKCIWFTLRLFLKQSCNELHNGYRAKFLT--IV--YWIAATYVLADVYSAQLTSQFARPAREP 498

  Fly   660 PIESASDL------------AEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVK 712
            ||.:...|            .|:...|...||.|:.:  ||.    :|..|.:.:.|.....|:.
  Fly   499 PINTLQRLQAAMIHDGYRLYVEKESSSLEMLENGTEL--FRQ----LYALMRQQVINDPQGFFID 557

  Fly   713 TYEDGIKRVMEG--SYAFLMESTMLDYAVQR-DCNLTQIGGLLDSKGYGIATPKGSPWRDKISLA 774
            :.|.|||.:.||  ..|.|.....|.:.||: ..|..|:...|.::...:|...|.|:...::..
  Fly   558 SVEAGIKLIAEGGEDKAVLGGRETLFFNVQQYGSNNFQLSQKLYTRYSAVAVQIGCPFLGSLNNV 622

  Fly   775 ILELQEKGIIQIL----YDKWW---------------KNTGDVCNRDDKSKESKANALGVENIGG 820
            :::|.|.||:..:    |.|.:               ||: :..:|.:....:..:.|.:..:.|
  Fly   623 LMQLFESGILDKMTAAEYAKQYQEVEATRIYKGSVQAKNS-EAYSRTESYDSTVISPLNLRMLQG 686

  Fly   821 VFVVLLCGLALAVVVAIFE 839
            .|:.|..|...|.|:.:.|
  Fly   687 AFIALGVGSLAAGVILLLE 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11155NP_651941.2 PBP1_iGluR_Kainate 44..410 CDD:107377 2/6 (33%)
ANF_receptor 61..393 CDD:279440
PBP2_iGluR_Kainate 424..793 CDD:270432 97/464 (21%)
Lig_chan 555..829 CDD:278489 71/341 (21%)
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 25/128 (20%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 24/98 (24%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 35/146 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463014
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.