DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11155 and F59E12.8

DIOPT Version :10

Sequence 1:NP_651941.2 Gene:CG11155 / 43822 FlyBaseID:FBgn0039927 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001364714.1 Gene:F59E12.8 / 186629 WormBaseID:WBGene00019123 Length:379 Species:Caenorhabditis elegans


Alignment Length:113 Identity:23/113 - (20%)
Similarity:42/113 - (37%) Gaps:37/113 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ENNLKAVEQSKEDEHQRNIDRI----LKESKEKNKAALL-------QVSQQIQEENS--IRRRKN 117
            ||.||.:.........:::|.:    |...|...:.|||       ::.|.::|::.  :.|||:
 Worm     2 ENELKRLRLLTRRMTCKDLDGLTFPELLSLKSHLQTALLIVKDQTKKIEQLLKEDDGWMLIRRKD 66

  Fly   118 IE-----------------------KKAEIEKLKIQSKLDHEKKDREP 142
            .|                       .:|....|. |.:|..|:::.||
 Worm    67 AEDGMGREVSVPCKFSTSSTGERQGDEAPAPPLS-QLQLQFERRNAEP 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11155NP_651941.2 PBP1_iGluR_Kainate 44..413 CDD:380605 23/113 (20%)
PBP2_iGluR_Kainate 424..793 CDD:270432
Lig_chan 554..828 CDD:459656
F59E12.8NP_001364714.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.