DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif3C and kif19

DIOPT Version :9

Sequence 1:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_005156460.1 Gene:kif19 / 565913 ZFINID:ZDB-GENE-080215-2 Length:1015 Species:Danio rerio


Alignment Length:590 Identity:184/590 - (31%)
Similarity:293/590 - (49%) Gaps:77/590 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENIKVVVRCRPMNQTEKERNCQNIV-EINEFAVSVTNP--------SARISQQKKFIFDSVYNMK 58
            :.:.|.:|.||::..|.|.....|. ::::..|.:.:|        .|..|::|.::||..::..
Zfish    10 QQLTVALRIRPLSDAELEEGATIIAHKVDDQMVVLLDPMEDPDDILRAHRSREKTYMFDVAFDYS 74

  Fly    59 TDTEVIYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNSTGIIPKCFDHIFERIS 123
            ...:.:|......|:|..|.|||.|:||||.||||||:||.|.:   ...||..:..:.:|:.|.
Zfish    75 ATQDEVYRYTTKGLIEGLISGYNATVFAYGPTGCGKTYTMLGTD---REPGIYVRTLNDLFKAIE 136

  Fly   124 MTT-NVRYLALVTYLEIYNERIRDLLNKNENTNVINHF--LKELPGIGVSVPTLTTQPVVNANQC 185
            .|: :::|...::|||||||.||||||.:..      |  |:|.....:.|..:|....:||.:.
Zfish   137 ETSDDMQYSVSMSYLEIYNEMIRDLLNPSSG------FLDLREDSKGEIQVAGITEVSTINAREI 195

  Fly   186 YDWLHFGNKNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDAFGGICRGKLSLVDLAGSER 250
            .:.|..|||.|....|..|:.|||||.:..:.:.|    .|...|....:...:|.::|||||||
Zfish   196 MELLMKGNKQRTQEPTAANQTSSRSHAVLQVVVRQ----QSRCRDILQEVRFARLFMIDLAGSER 256

  Fly   251 QRKTGAQGDRLKEASQINLSLSALGNVISSLVDGKA-KHVPFRDSKLTRLLQDSLGGNTKTLMIS 314
            ..:|..:|.||||.:.||.||.||||.|::|.:... |:|.:|||||||||:||||||::|:||:
Zfish   257 ASQTQNRGQRLKEGAHINRSLLALGNCINALSEKNGNKYVNYRDSKLTRLLKDSLGGNSRTVMIA 321

  Fly   315 CISPTDIHYDETISTLRYASRAKNISNKPKINEDPKDARLRQY-------QNEILYLKRML--QE 370
            .|||..:.::::.:||.||.|||:|..:.|.|.......:.||       ::||..||:.:  |.
Zfish   322 HISPASLAFEDSRNTLTYADRAKSIRTRVKRNLLNVSYHIAQYTSIISDLRSEIQRLKKKIADQA 386

  Fly   371 SQQIINKNNDPNKIIKSPLKIIQHTNMNSTKNV-----QIIDLGRNCKASFKTNNSILTKPNFPL 430
            |:||   |.|...|.....::..|::..|...:     |:||       :|:....| .|....|
Zfish   387 SRQI---NPDRTDIRHVQAEVQAHSSQQSRAEMDQLREQLID-------AFRQQMDI-RKRLMEL 440

  Fly   431 IQSKEEVQLQARSRIDLIKRSLIGGERIHDFELKEKHMARKYAAQRHLSAIAIALSRVKCEDRDL 495
            ..|..|:|      ||..|..|    .|.|:|.:.....:|:..:|...:.....|....:..:.
Zfish   441 DNSNMEIQ------IDTSKHLL----TIADWEQERFRRRKKWQGERRKESFNKDESEKDSDSPES 495

  Fly   496 LQGHYATITQEIDIKNDYI-------RKCKEKIKMLEMEVSDLNSEFQLDREDYLDEIRNLGRQV 553
            |..  :|.|||:.|..:.:       :|.:::...||..:::|.     ::...|:|:  |.|:|
Zfish   496 LPD--STETQEVAIARENLVTLMAEQKKIQKQKAGLEQRLAELR-----EKARRLEEL--LPRRV 551

  Fly   554 KFHQQ 558
            ...:|
Zfish   552 SSEEQ 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 130/348 (37%)
Kinesin 10..339 CDD:278646 129/341 (38%)
kif19XP_005156460.1 KISc 11..353 CDD:214526 132/354 (37%)
KISc_KIP3_like 11..346 CDD:276821 130/347 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.