DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif3C and ncd

DIOPT Version :9

Sequence 1:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster


Alignment Length:362 Identity:133/362 - (36%)
Similarity:193/362 - (53%) Gaps:33/362 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NIKVVVRCRPMNQTEKERNCQNIVEINEFAVSVTNPSARISQ---QKKFIFDSVYNMKTDTEVIY 65
            ||:|..|.||..::|:.|.|......:|..|.:.:..|:...   |:.|.||.|::..:....|:
  Fly   348 NIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIF 412

  Fly    66 DEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNSTGIIPKCFDHIFERISMTTNV-- 128
             ||...|::|.::|||..||||||||.|||:||.|   ...|.|:||:..|.:|:.|....|:  
  Fly   413 -EMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDG---VPESVGVIPRTVDLLFDSIRGYRNLGW 473

  Fly   129 RYLALVTYLEIYNERIRDLLNKNENTNVINHFLKELPGIGVSVPTLTTQPVVNANQCYDWLHFGN 193
            .|....|:||||||.:.|||: ||..::.....|.... .:.|..:|.:.|::.|.....:|...
  Fly   474 EYEIKATFLEIYNEVLYDLLS-NEQKDMEIRMAKNNKN-DIYVSNITEETVLDPNHLRHLMHTAK 536

  Fly   194 KNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDA-FGGICRGKLSLVDLAGSERQRKTGAQ 257
            .||.||:|..|:.|||||.:..:.|        ||..| ...|..|.::||||||||..:.:   
  Fly   537 MNRATASTAGNERSSRSHAVTKLEL--------IGRHAEKQEISVGSINLVDLAGSESPKTS--- 590

  Fly   258 GDRLKEASQINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDSLGGNTKTLMISCISPTDIH 322
             .|:.|...||.|||.|.|||.:|:. |..|:|:|:||||.||..|||||:||||...:||....
  Fly   591 -TRMTETKNINRSLSELTNVILALLQ-KQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDC 653

  Fly   323 YDETISTLRYASRAKNISNKPKINEDPKDARLRQYQN 359
            :.|::.:||:|:..    |..|:.:    |:..:|.|
  Fly   654 FQESVKSLRFAASV----NSCKMTK----AKRNRYLN 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 128/340 (38%)
Kinesin 10..339 CDD:278646 125/334 (37%)
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 129/346 (37%)
KISc 348..678 CDD:214526 131/356 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437707
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.