DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif3C and Klp59C

DIOPT Version :9

Sequence 1:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster


Alignment Length:469 Identity:145/469 - (30%)
Similarity:208/469 - (44%) Gaps:79/469 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKVVVRCRPMNQTEKERNCQNIVEI-NEFAVSVTNPSARIS-----QQKKFIFDSVYNMKTDTEV 63
            |.|.||.||:.:.|.....|::|.| ::..:.|..|...::     :...|.||.|::.:.....
  Fly   188 IMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEECSNAT 252

  Fly    64 IYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGD---ENFSNSTGIIPKCFDHIFERISMT 125
            :|:.....|::...:|...|.|||||||.|||:||.|.   .:.|:..||.......:|..:. |
  Fly   253 VYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLK-T 316

  Fly   126 TNVRYLALVTY---LEIYNERIRDLL-----------NKNENTNVINHFLKELPGIGVSVPTLTT 176
            .....|.|..|   .|||..|:.|||           ::|:...|:.               ||.
  Fly   317 VPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVG---------------LTQ 366

  Fly   177 QPVVNANQCYDWLHFGNKNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDAFGGICRGKLS 241
            .||.|..:..|.|..||..|.:..|..|..|||||.:|.|.|.          .|.|....||.|
  Fly   367 NPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLR----------SAAGEKLHGKFS 421

  Fly   242 LVDLAGSER--QRKTGAQGDRLKEASQINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDS- 303
            |:||||:||  ...:..:..|| |.|:||.||..|...|.:| ..::.|:|||.||||::|:|| 
  Fly   422 LIDLAGNERGADNSSADRQTRL-EGSEINKSLLVLKECIRAL-GRQSSHLPFRGSKLTQVLRDSF 484

  Fly   304 LGG-NTKTLMISCISPTDIHYDETISTLRYASRAKNISNKPKINEDPKDARLRQYQNEILYLKRM 367
            :|| ..||.||:.|||.....:.|::|||||.|.|.:|.:...::...||.|.......:..:..
  Fly   485 IGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKELSVESIPSKRMPDANLGSTSMSDIVCQSS 549

  Fly   368 LQESQQIINKNNDPNKIIKSPLKIIQHTNMNSTKNVQIIDLGRNCKASFKTNNSILTKPNFP--- 429
            .|......:..:.|.    ...:..||||   |.|    ||.|:.|.:        :||.:|   
  Fly   550 TQRLFPCASSTSMPG----GGNQAQQHTN---TAN----DLNRSQKPT--------SKPTYPTSG 595

  Fly   430 --LIQSKEEVQLQA 441
              |:|.|...|.:|
  Fly   596 QQLVQRKGSSQREA 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 121/360 (34%)
Kinesin 10..339 CDD:278646 118/355 (33%)
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 120/358 (34%)
Kinesin 193..520 CDD:278646 117/354 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437695
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.