DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif3C and Cenpe

DIOPT Version :9

Sequence 1:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_038959788.1 Gene:Cenpe / 362044 RGDID:1307115 Length:2456 Species:Rattus norvegicus


Alignment Length:611 Identity:201/611 - (32%)
Similarity:304/611 - (49%) Gaps:75/611 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEN--IKVVVRCRPMNQTEKERNCQNIVEINEFAVSVTNPSARISQQKKFIFDSVYNMKTDTEV 63
            |:|.  :.|.||.||:|..|:|....:.:    :..:..|...:....|.|.||.|::....|:.
  Rat     1 MAEEAAVAVCVRVRPLNSREEELGEASHI----YWKTDKNAIYQSDGGKSFQFDRVFHSNETTKN 61

  Fly    64 IYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNSTGIIPKCFDHIFERISMTTNV 128
            :|:|:...::.|.|:||||||||||||..||||||.|.|   :..|:||:....||:||......
  Rat    62 VYEEIAVPIISSAIQGYNGTIFAYGQTASGKTHTMMGSE---DCLGVIPRAIHDIFQRIKKFPER 123

  Fly   129 RYLALVTYLEIYNERIRDLLNKNENTNVINHFLKELPGIGVSVPTLTTQPVVNANQCYDWLHFGN 193
            .:|..|:|:|||||.|.|||...:....:  .::|.....|.|..||.:.|..|.....||..|.
  Rat   124 EFLLRVSYMEIYNETITDLLCNTQKVKPL--IIREDINRNVYVADLTEEVVYTAEMALKWLATGE 186

  Fly   194 KNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDAFGGICRGKLSLVDLAGSERQRKTGAQG 258
            |||....|.||:.||||||||.:.||......|...|  |.|....|:|||||||||..:|||:|
  Rat   187 KNRHYGITKMNQRSSRSHTIFRMILESREKAESSNCD--GSIKVSHLNLVDLAGSERAAQTGAEG 249

  Fly   259 DRLKEASQINLSLSALGNVISSLVDGK-AKHVPFRDSKLTRLLQDSLGGNTKTLMISCISPTDIH 322
            .||||...||.:|..||.||..|.||: ...:.:|||||||:||:|||||.||.:|..|:|..: 
  Rat   250 MRLKEGCYINRNLLILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNAKTRIICTITPASL- 313

  Fly   323 YDETISTLRYASRAKNISNKPKINEDPKD-ARLRQYQNEILYLKRMLQESQQIINKNNDPNKIIK 386
             |||::||::||.||.:.|.|.:||...| |.|::|:.||:.||:.|:|    :|......:|.|
  Rat   314 -DETLTTLQFASTAKYMKNTPYVNEVSNDEALLKRYRREIVDLKKQLEE----VNTKTRAQEIEK 373

  Fly   387 SPL-KIIQHTNMNSTKNVQIIDLGRNCKASFKTNNSILTKPNFPLIQSKEEVQLQARSRIDLIKR 450
            ..| :::...::  .:.||...: :|.|....|::||..         ::|::::.:.|:.....
  Rat   374 DQLAQLLDEKDL--LQKVQDEKI-QNLKRMLVTSSSIAL---------QQELEIKKKRRVTWCFG 426

  Fly   451 SLIGGERIHDFELKEKHMAR----KYAAQRHLSAIAIALSRVKCED-------RDLLQGHYATIT 504
            .:.....:.:|::......|    .....|..|.:.:..|.:..|.       ..|.:..:::.|
  Rat   427 KMKDSNYVKEFKIPTNITTRTRKTSVTPLRENSLMKLGESALSWESEVFDNTLEPLAEAEWSSAT 491

  Fly   505 QEIDIKN-----------------DY--IRKCKEKIKMLEMEVSDLNS-EFQLDRED------YL 543
            ..:..:|                 ||  :|:..|.:|:...|.::|.. ||...||:      .:
  Rat   492 ALLSEENLESELTSLNTQYNNLVLDYEQLRRENEDLKLKLKEKNELEEFEFLEQREEKDQELQLM 556

  Fly   544 DEIRNLGRQVK----FHQQLFLKFSS 565
            .|:.||...:|    ::|.|..:.||
  Rat   557 HEVSNLKNLIKHAEEYNQDLENELSS 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 145/338 (43%)
Kinesin 10..339 CDD:278646 142/329 (43%)
CenpeXP_038959788.1 KISc_CENP_E 6..329 CDD:276825 144/335 (43%)
Smc <334..1057 CDD:224117 53/265 (20%)
Smc 787..1603 CDD:224117
Smc 1320..2167 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.