DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Kif3C and Ggamma1

DIOPT Version :9

Sequence 1:	NP_651939.4	Gene:	Kif3C / 43820	FlyBaseID:	FBgn0039925	Length:	649	Species:	Drosophila melanogaster
Sequence 2:	NP_523662.1	Gene:	Ggamma1 / 35881	FlyBaseID:	FBgn0004921	Length:	70	Species:	Drosophila melanogaster

Alignment Length:	46	Identity:	12/46 - (26%)
Similarity:	20/46 - (43%)	Gaps:	6/46 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   528 VSDLNSEFQLDREDYLDEIRNLGRQVKFHQQ---LFLKFSS---NP 567
            |..|..|..:||:...:....:.:.:..|:|   |...|:|   ||
  Fly    15 VEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNP 60

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Kif3C	NP_651939.4	Motor_domain	3..339	CDD:277568
Kif3C	NP_651939.4	Kinesin	10..339	CDD:278646
Ggamma1	NP_523662.1	GGL	8..65	CDD:238024	12/46 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG4280
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900