DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif3C and neb

DIOPT Version :9

Sequence 1:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_476817.1 Gene:neb / 35293 FlyBaseID:FBgn0004374 Length:1121 Species:Drosophila melanogaster


Alignment Length:526 Identity:173/526 - (32%)
Similarity:265/526 - (50%) Gaps:104/526 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NIKVVVRCRPMNQTEKER-NCQNIVEI----NEFAV---SVTNPSARISQQKKFIFDSVYNMKTD 60
            |:.|.||.||:|..|..| ...|:|::    ||..|   |..:.||.::.  .|.:|.|| ...|
  Fly   120 NMIVAVRVRPLNALECTRGQVTNVVQVHGNSNELTVQAGSSADASAGVTH--FFSYDQVY-YSCD 181

  Fly    61 TE--------VIYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNS---------- 107
            .|        .:::.....|:::..||||..:|||||||.||:::|.|.|...::          
  Fly   182 PERKNFACQAKVFEGTARPLIDTAFEGYNACLFAYGQTGSGKSYSMMGIEALDDAALDGGPPHDE 246

  Fly   108 TGIIPKCFDHIFERISMTTNVRYLAL---VTYLEIYNERIRDLLN-------KNENTNVINH--- 159
            .||||:....:|.||....:.:.|.:   |:|.|||||:|.|||:       ..|:|.:...   
  Fly   247 AGIIPRFCHELFRRIEAVKSQQQLQVEVEVSYFEIYNEKIHDLLSVQHAAAATGESTPIQQQQQQ 311

  Fly   160 -----FLKELPGIGVSVPTLTTQPVVNANQCYDWLHFGNKNRVTAATLMNKNSSRSHTIFTITLE 219
                 .::|.|..|..|..|:...|.:.:...:||..||..|.||:|.||..|||||:||.|.|.
  Fly   312 QRPALKVREHPIFGPYVVDLSAHSVDSYSALRNWLAVGNSQRATASTAMNDKSSRSHSIFNIVLN 376

  Fly   220 QSPFLNSIGSDAFGGIC---------------RGKLSLVDLAGSERQRKTGAQGDRLKEASQINL 269
                |..:.||  .|:.               |.|:||||||||||...:|:.|:|::|...||.
  Fly   377 ----LTDLSSD--DGLSSDTDSSTASSLRQTRRSKISLVDLAGSERISVSGSNGERIREGVSINK 435

  Fly   270 SLSALGNVISSLVDGK-------------AKHVPFRDSKLTRLLQDSLGGNTKTLMISCISPTDI 321
            ||..||.||::|.|.:             :..||:|:|.||.||:::||||:||:|::.|||..|
  Fly   436 SLLTLGKVIAALADSRKAIANGPLGSGTPSTFVPYRESVLTWLLRENLGGNSKTVMLATISPASI 500

  Fly   322 HYDETISTLRYASRAKNISNKPKINEDPKDARLRQYQNEILYLKRMLQE---SQQIINKNNDPNK 383
            |.|||::|||||.:|::|.|:.|:||.|.|..:|..:.|:..||.:..|   .:::...:|:|  
  Fly   501 HADETLATLRYACKARSIVNRVKVNESPHDKIIRDLRAEVDRLKSLRNEYERQRRLSGNSNNP-- 563

  Fly   384 IIKSPLKIIQHTNMNSTK----NVQIIDLGRNCKASFKTNNSILTKPNFPLIQSKEEVQLQARSR 444
               .|.|||..|:::.|:    ..|:.:..|.           |::.....::..:|.:.|.:|.
  Fly   564 ---VPRKIIIETSVDETEVEALRQQLAERERE-----------LSRAQKSWMEKLKEAEDQRKSE 614

  Fly   445 IDLIKR 450
            :.::||
  Fly   615 LRVLKR 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 145/406 (36%)
Kinesin 10..339 CDD:278646 142/400 (36%)
nebNP_476817.1 KISc_KIF1A_KIF1B 119..525 CDD:276816 148/413 (36%)
KISc 120..525 CDD:214526 148/413 (36%)
Kinesin_assoc 524..657 CDD:292801 25/113 (22%)
FHA 634..740 CDD:238017
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.