DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif3C and Kif26a

DIOPT Version :9

Sequence 1:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_006240697.1 Gene:Kif26a / 314473 RGDID:1307957 Length:1881 Species:Rattus norvegicus


Alignment Length:370 Identity:99/370 - (26%)
Similarity:175/370 - (47%) Gaps:45/370 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKVVVRCRPMNQTEKERNCQNIVEINEFAVSVT----------------NPSARISQQKKFIFDS 53
            :||::|..|....::.....:.::::.....||                .|:|.:  .|.|.||:
  Rat   365 VKVMLRIWPAQGVQRSAESTSFLKVDSRKKQVTLYDPAAGPPGCAGLRHAPTAPV--PKMFAFDA 427

  Fly    54 VYNMKTDTEVIYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNSTGIIPKCFDHI 118
            ::...::...:.......:::|.:.|.:|.||::|....||::||.|.::...|.||:|.....:
  Rat   428 IFPQDSEQAEVCSGTVADVLQSVVGGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWL 492

  Fly   119 F-------ERISMTTNVRYLALVTYLEI--YNERIRDLLNK-----NENTNVINHFLKELPGIGV 169
            |       ||:....::|    |:.:|:  :::.:||||.:     .::|.....:|:|.|..|.
  Rat   493 FRLIDERKERLGTRFSIR----VSAVEVCGHDQSLRDLLAEVASGCLQDTQSPGVYLREDPVCGT 553

  Fly   170 SVPTLTTQPVVNANQCYDWLHFGNKNRVTAATLMNKNSSR-SHTIFTITLEQSPFLNSIGSDAFG 233
            .:..........|.:...:|......|.|:.....:::.| ||.:||:.:.|.. :...|.....
  Rat   554 QLRNQNELRAPTAEKAAFYLDAALAARSTSRAGCGEDARRTSHMLFTLHVYQYR-VEKCGQGGMS 617

  Fly   234 GICRGKLSLVDLAGSERQRKTGAQGDRLKEASQINLSLSALGNVISSLVDGKAKHVPFRDSKLTR 298
            | .|.:|.|:||...|.....|.:.    ....:.|||||||:||.:||:| |||||:||..||.
  Rat   618 G-GRSRLHLIDLGSCEAAPSRGGEA----SGGPLCLSLSALGSVILALVNG-AKHVPYRDHTLTM 676

  Fly   299 LLQDSLGGNT-KTLMISCISPTDIHYDETISTLRYASRAKNISNK 342
            ||::||...: .|.||:.||.:..|:.||:||::.|:|...:..|
  Rat   677 LLRESLATTSCCTTMIAHISDSPTHHAETLSTVQLAARIHRLRRK 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 98/365 (27%)
Kinesin 10..339 CDD:278646 96/360 (27%)
Kif26aXP_006240697.1 KISc 364..716 CDD:276812 98/363 (27%)
KISc 365..725 CDD:214526 99/370 (27%)
PRK07764 <837..1309 CDD:236090
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.