DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif3C and Kif26b

DIOPT Version :9

Sequence 1:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_038946745.1 Gene:Kif26b / 305012 RGDID:1560022 Length:2138 Species:Rattus norvegicus


Alignment Length:365 Identity:103/365 - (28%)
Similarity:176/365 - (48%) Gaps:38/365 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKVVVR-CRPMNQTEKERNCQNIVEINEFAVSVTNP---------SARISQ--QKKFIFDSVYNM 57
            :||::| |....:...|.:....|:..:..:::.:|         ..|.||  .|.|.||:|:..
  Rat   471 VKVMLRICSASARDTSESSSFLKVDPRKKQITLYDPLTCGGHNAFQKRSSQVPPKMFAFDAVFPQ 535

  Fly    58 KTDTEVIYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNSTGIIPKCFDHIFERI 122
            ......:.......:::|.:.|.:|.:|.:|....||::||.|.::...:.||||.....:|:.|
  Rat   536 DASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGRDDSMQNLGIIPCAISWLFKLI 600

  Fly   123 S---MTTNVRYLALVTYLEIY--NERIRDLLNK--------NENTNVINHFLKELPGIGVSVPTL 174
            :   ..|..|:...::.:|::  .|.:||||::        .::..|   :|.|.|..|..:...
  Rat   601 NERKEKTGARFSVRISAVEVWGKEENLRDLLSEVATGSLQDGQSPGV---YLCEDPICGTQLQNQ 662

  Fly   175 TTQPVVNANQCYDWLHFGNKNRVTAATLMNKNSSR-SHTIFTITLEQSPFLNSIGSDAFGGICRG 238
            :......|.:...:|.....:|.:.....:::..| ||.:||:.:.|.....|......||  |.
  Rat   663 SELRAPTAEKAAFFLDAAIASRRSNQQDCDEDDHRNSHMLFTLHIYQYRMEKSGKGGMSGG--RS 725

  Fly   239 KLSLVDLAGSERQRKTGAQGDRLKEASQINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDS 303
            :|.|:||....:......:|     .|.:.||||||||||.:||:| :||:|:::||||.||::|
  Rat   726 RLHLIDLGSCVKALSKNREG-----GSGLCLSLSALGNVILALVNG-SKHIPYKESKLTMLLRES 784

  Fly   304 LGG-NTKTLMISCISPTDIHYDETISTLRYASRAKNISNK 342
            ||. |.:|.||:.||.....|.||:||::.|||...:..|
  Rat   785 LGNVNCRTTMIAHISAAAGSYAETLSTIQIASRVLRMKKK 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 102/360 (28%)
Kinesin 10..339 CDD:278646 100/355 (28%)
Kif26bXP_038946745.1 KISc 470..818 CDD:276812 101/357 (28%)
PHA03307 1721..>2012 CDD:223039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.