DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif3C and CG32318

DIOPT Version :9

Sequence 1:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster


Alignment Length:97 Identity:33/97 - (34%)
Similarity:50/97 - (51%) Gaps:14/97 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SENIKVVVRCRPMNQTEKERNCQNIVEINEFAVSVTNPSARISQQ-------KKFIFDSVYNMKT 59
            ::||:|.||.||:|..|:   |....|:    |.|..|...:::.       |||.||..:..::
  Fly    17 NQNIQVYVRVRPLNSRER---CIRSAEV----VDVVGPREVVTRHTLDSKLTKKFTFDRSFGPES 74

  Fly    60 DTEVIYDEMCYSLVESTIEGYNGTIFAYGQTG 91
            ....:|..:...|:|..:.|||.|:|||||||
  Fly    75 KQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTG 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 33/96 (34%)
Kinesin 10..339 CDD:278646 29/89 (33%)
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 31/95 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.