DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif3C and Kif11

DIOPT Version :9

Sequence 1:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001162583.1 Gene:Kif11 / 171304 RGDID:621258 Length:1056 Species:Rattus norvegicus


Alignment Length:591 Identity:189/591 - (31%)
Similarity:295/591 - (49%) Gaps:91/591 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENIKVVVRCRPMNQTEKERNCQNIVEINEFAVSVTNPSARI---SQQKKFIFDSVYNMKTDTEVI 64
            :||:|||||||.|..|::.|..::||.:.....|:..:|.:   :.:|.:.||.|:...|....:
  Rat    17 KNIQVVVRCRPFNLAERKANAHSVVECDHARKEVSVRTAGLTDKTSRKTYTFDMVFGASTKQIDV 81

  Fly    65 YDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSN--------STGIIPKCFDHIFER 121
            |..:...:::..|.|||.|||||||||.|||.||:|:.:.:.        ..||||:....|||:
  Rat    82 YRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSPNEVYTWEEDPLAGIIPRTLHQIFEK 146

  Fly   122 ISMTTNVRYLALVTYLEIYNERIRDLLNKNENTNV-INHFLKELPGIGVSVPTLTTQPVVNANQC 185
            :: .....:...|:.||||||.:.|||:.:.:.:. :..|.......||.:..|....|.|.::.
  Rat   147 LT-DNGTEFSVKVSLLEIYNEELFDLLSPSSDVSERLQMFDDPRNKRGVIIKGLEEITVHNKDEV 210

  Fly   186 YDWLHFGNKNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDAFGGICRGKLSLVDLAGSER 250
            |..|..|...|.|||||||..|||||::|::|:....  .:|..:....|  |||:||||||||.
  Rat   211 YQILEKGAAKRTTAATLMNAYSSRSHSVFSVTIHMKE--TTIDGEELVKI--GKLNLVDLAGSEN 271

  Fly   251 QRKTGAQGDRLKEASQINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDSLGGNTKTLMISC 315
            ..::||...|.:||..||.||..||.||::||: :..|:|:|:|||||:|||||||.|:|.:|:.
  Rat   272 IGRSGAVDKRAREAGNINQSLLTLGRVITALVE-RTPHIPYRESKLTRILQDSLGGRTRTSIIAT 335

  Fly   316 ISPTDIHYDETISTLRYASRAKNISNKPKINED-PKDARLRQYQNEILYLKRMLQESQQIINKNN 379
            |||..::.:||:|||.||.|||||.|||::|:. .|.|.:::|..||..|||.|..:::      
  Rat   336 ISPASLNLEETLSTLEYAHRAKNIMNKPEVNQKLTKKALIKEYTEEIERLKRDLAAARE------ 394

  Fly   380 DPNKIIKSPLKIIQHTNMNSTKNVQIIDLGRNCKASFKTNNSILTKPNFPLIQSKEEVQLQARSR 444
                                 ||...|.     :.||:..|..:|      :|.::..:|  ..:
  Rat   395 ---------------------KNGVYIS-----EESFRAMNGKVT------VQEEQIAEL--AEK 425

  Fly   445 IDLIKRSLIGGERIHDFELKEKHMARKYAAQRHLSAIAIALSRVKCEDRDLLQGHYATITQEIDI 509
            |.:::..|.....:.....||.:..:...             :.|.::.:..|.|......:: :
  Rat   426 IGVLEEELSKAAELFTDSEKELNQCKSDL-------------QTKTQELETTQKHLQETKLQL-V 476

  Fly   510 KNDYIRKCKEK---------------IKMLEMEVSDLNSEFQLDREDYLDEIRNLGRQVKFHQQL 559
            |.:|:....|:               :|....:||.|:|  :|||:..:| ..|...|..|.:.|
  Rat   477 KEEYVSSALERTEKKLHETASKLLNTVKETTRDVSGLHS--KLDRKRAID-AHNAEAQESFGRSL 538

  Fly   560 FLKFSS 565
            ...|::
  Rat   539 SSLFNN 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 141/347 (41%)
Kinesin 10..339 CDD:278646 136/340 (40%)
Kif11NP_001162583.1 KISc_BimC_Eg5 16..368 CDD:276815 147/356 (41%)
KISc 18..366 CDD:214526 146/353 (41%)
DUF4795 416..>486 CDD:292662 10/85 (12%)
Microtub_bind 916..1052 CDD:290642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.